Phosphate Buffered Saline (PBS) is a sterile, nonpyrogenic buffer solution formulated to maintain a stable physiological pH. It is commonly used in laboratory research environments where consistent pH and isotonic conditions are required.
PBS is suitable for general buffering and dilution applications and is supplied ready for laboratory use. The solution is designed to support controlled handling during research procedures without introducing variability.
This product is provided strictly for laboratory research purposes.
Key Features
• Sterile, nonpyrogenic buffer solution
• Physiological pH (≈7.4)
• Suitable for buffering and dilution in laboratory settings
• Supplied in sealed vials
• Available in 3ml and 10ml formats
Important Notice
This product is intended for research use only (RUO).
Not for human or veterinary use.
Not for diagnostic, therapeutic, or clinical purposes.
Tesamorelin 5mg – High-Purity Research Peptide
Tesamorelin is a synthetic growth-hormone–releasing hormone (GHRH) analogue consisting of 44 amino acids. It has been widely investigated for its potential role in growth hormone secretion, fat metabolism, and age-related endocrine studies. Supplied in lyophilised (freeze-dried) form, Bluewell Tesamorelin is HPLC-verified for purity and manufactured under strict quality standards to meet research-grade requirements.
Scientific Identifiers
Product Name: Tesamorelin 2mg
Catalogue Number: BWP-TESA-2
CAS Number: 218949-48-5
Unit Size: 5mg
Form: Lyophilised Solid
Purity: >99.1% (HPLC Verified)
Molecular Formula: C₂₂₁H₃₆₆N₇₄O₆₇S
Molecular Weight: 5135.9 g/mol
Storage: Store at −20°C in a dry, dark environment
Usage and Reconstitution
Tesamorelin is supplied in freeze-dried form for maximum stability. For laboratory research use, it may be reconstituted with bacteriostatic water or a suitable solvent following standard protocols. For further guidance, see our [Reconstitution Guide].
Research Applications of Tesamorelin
Research into Tesamorelin has explored its potential roles in:
Endocrinology & Growth Hormone Research – Studied for its effects on stimulating growth hormone release and metabolic regulation.
Adipose Tissue Studies – Investigated for its potential in reducing visceral adipose tissue and supporting metabolic health.
Age-Related Research – Explored for possible applications in muscle preservation, fat redistribution, and metabolic balance.
References are available on request or in our research archive.
Why Order Tesamorelin from Cali BioLab Peptides?
Verified 99.1% purity, HPLC-tested
COA provided with every batch
Secure checkout and fast USA delivery
Trusted, transparent research supplier
Backed by expert support and positive reviews
Retatrutide GLP-3 RT 30mg Peptide – The Triple-Agonist Breakthrough Redefining Metabolic Research Horizons
What if a single investigational peptide could simultaneously activate three major metabolic hormone pathways—GLP-1 for appetite suppression and glucose control, GIP for enhanced insulin secretion and fat utilization, and glucagon for increased energy expenditure and fat breakdown—delivering weight loss results in clinical trials that eclipse even the most potent dual-agonists, while offering researchers an unprecedented tool to dissect synergistic hormone signaling in obesity, type 2 diabetes, and metabolic dysfunction models? This is the game-changing reality of Retatrutide GLP-3 RT 30mg Peptide, the first-in-class triple receptor agonist (GLP-1R/GIPR/GCGR) that's rapidly becoming a cornerstone compound in advanced metabolic, endocrinology, and obesity research.
At Cali BioLab Peptides, Retatrutide GLP-3 RT 30mg Peptide is supplied as a high-purity (≥99%), sterile lyophilized powder in a 30mg research vial—third-party HPLC/MS verified, batch-specific Certificates of Analysis provided, and shipped fast within the USA. This generous 30mg format supports extensive dose-response curves, chronic administration protocols, large-animal cohorts, or multi-replicate cell/organoid studies for qualified investigators.
Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.
The Landmark Phase 2 Trial That Redefined Expectations: The Obesity Study That Shocked Investigators
In 2023, a multicenter phase 2 trial (published in NEJM) enrolled adults with obesity (BMI ≥30) or overweight (BMI ≥27 with comorbidities) without diabetes. Participants received once-weekly subcutaneous Retatrutide GLP-3 RT at escalating doses (1 mg to 12 mg) or placebo for 48 weeks. The results stunned the field: at the highest dose (12 mg), mean weight loss reached -24.2% from baseline (placebo-adjusted ≈-22%), with over 50% of participants achieving ≥25% reduction—numbers that surpassed semaglutide and tirzepatide in similar trial designs. Glycemic control improved dramatically (HbA1c reductions up to -2.0%), liver fat content dropped by >80% in NAFLD subgroups, and lipid profiles normalized (significant LDL and triglyceride reductions).
The trial also highlighted a favorable safety profile: gastrointestinal events were common but mostly mild/transient, with no severe hypoglycemia and low discontinuation rates. Investigators noted the glucagon component appeared to drive additional energy expenditure and liver fat clearance beyond GLP-1/GIP effects. This pivotal study—often cited as one of the most impressive weight-loss results ever reported in a phase 2 setting—propelled Retatrutide GLP-3 RT into phase 3 programs and made it a must-have probe for any lab modeling triple-agonist mechanisms or superior metabolic outcomes.
What Is Retatrutide GLP-3 RT 30mg Peptide?
Retatrutide GLP-3 RT 30mg Peptide (LY3437943) is an investigational, long-acting triple agonist peptide that simultaneously activates glucagon-like peptide-1 receptor (GLP-1R), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon receptor (GCGR). It is a synthetic analog engineered for once-weekly subcutaneous administration in clinical development, with a structure optimized for high potency and extended half-life.
In research contexts,Retatrutide GLP-3 RT 30mg Peptide is supplied as a white-to-off-white lyophilized powder in a 30mg vial, allowing researchers to explore its multi-receptor pharmacology at various concentrations and durations.
Scientific Identifiers for Retatrutide GLP-3 RT 30mg Peptide
Chemical Name: Retatrutide (LY3437943)
CAS Number: 2381089-83-2
Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈
Molecular Weight: ≈4731.33 Da
Sequence: Proprietary 39-amino-acid sequence with strategic modifications for triple-receptor agonism and stability (exact sequence is confidential but confirmed in literature as a GHRP-like backbone with GLP-1/GIP/glucagon pharmacophores)
EC₅₀ Values (approximate from preclinical data): GLP-1R ~0.1 nM, GIPR ~0.5 nM, GCGR ~5 nM (balanced potency across receptors)
Purity: ≥99% (HPLC/MS verified)
Appearance: White lyophilized powder
Solubility: Excellent in bacteriostatic water or PBS (up to 10–20 mg/mL)
These identifiers position Retatrutide GLP-3 RT 30mg Peptide as the leading triple-agonist research tool available.
How Retatrutide GLP-3 RT 30mg Peptide Works in Research Models
Retatrutide GLP-3 RT 30mg Peptide exerts its effects through balanced activation of three receptors:
GCGR: Increases energy expenditure, stimulates hepatic glycogenolysis/lipolysis, promotes fat oxidation and ketogenesis.
This triple agonism creates synergy: GLP-1/GIP curb intake and improve glucose control, while glucagon drives calorie burning and liver fat clearance—leading to greater weight loss and metabolic improvements than dual agonists in preclinical and early clinical data.
Usage and Reconstitution Guidelines for Retatrutide GLP-3 RT 30mg Peptide
Allow vial to reach room temperature.
Add 1–3 mL bacteriostatic water or sterile PBS; gently swirl (avoid shaking).
Prepare stock solutions (e.g., 10 mg/mL) and dilute for working concentrations (typically 0.1–10 mg/kg in vivo or nM–μM in vitro).
Aliquot immediately → store at –80 °C. Thawed aliquots stable 2–8 °C for days.
Common research routes: subcutaneous injection (most frequent in animal models). Use sterile technique.
Research Applications of Retatrutide GLP-3 RT 30mg Peptide
Retatrutide GLP-3 RT 30mg Peptide is applied in:
Diet-induced obesity (DIO) and weight-loss reversal models
Type 2 diabetes analogs (glucose homeostasis, β-cell function)
Frequently Asked Questions About Retatrutide GLP-3 RT 30mg Peptide
Q: How does Retatrutide GLP-3 RT 30mg Peptide differ from tirzepatide? A: Retatrutide GLP-3 RT 30mg Peptide adds glucagon receptor agonism to GLP-1/GIP dual action, driving higher energy expenditure and liver fat clearance—often yielding greater weight loss in trials.
Q: What dosing ranges are common in preclinical models? A: In-vivo rodent studies typically use 0.3–10 mg/kg subcutaneous weekly; adjust for species and duration.
Q: Is Retatrutide GLP-3 RT 30mg Peptide stable after reconstitution? A: Yes—stable for weeks refrigerated when aliquoted; freeze for longer storage.
Q: Can it be used in NAFLD or cardiovascular models? A: Yes—preclinical and early clinical data show robust liver fat reduction and cardiometabolic benefits.
Q: How to verify batch quality? A: Match the provided COA on the product page.
One Question That Could Shape Your Next Metabolic Research Project
If you could deploy Retatrutide GLP-3 RT 30mg Peptide right now in a DIO or NAFLD model, which synergistic mechanism—GLP-1-driven appetite suppression, GIP-enhanced insulin action, or glucagon-mediated energy expenditure—would you dissect first, and what key metabolic endpoint would you prioritize to demonstrate triple-agonist superiority?
Your answer might just define your next major study.
In summary, Retatrutide GLP-3 RT 30mg Peptide from Cali BioLab Peptides is the leading triple-agonist research tool for obesity, diabetes, and metabolic disease models. With exceptional purity, ample supply, and compelling preclinical/clinical evidence of superior efficacy, it's ready to power your 2026 metabolic breakthrough investigations.
Order your Retatrutide GLP-3 RT 30mg Peptide today at Cali BioLab Peptides and explore triple-hormone receptor synergy with precision and confidence.
Peptide Solution Atomiser Nasal Spray Bottle – The Precision Delivery System Revolutionizing Intranasal Peptide Research
What if a compact, user-friendly device could transform how researchers administer peptides intranasally—delivering fine mists for optimal absorption, minimizing waste, ensuring consistent dosing, and unlocking new insights into CNS penetration, bioavailability, and neuroendocrine effects without invasive injections? This is the game-changing potential of the Peptide Solution Atomiser Nasal Spray Bottle, a sterile, high-quality spray bottle designed specifically for reconstituting and delivering peptide solutions in controlled laboratory models, making it easier than ever to study brain-targeted therapies or mucosal delivery systems.
At Cali BioLab Peptides, the Peptide Solution Atomiser Nasal Spray Bottle is available in versatile sizes for research needs—shop now at https://www.calibiolabpeptides.com/ for fast USA shipping and lab-grade reliability.
Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.
The Lab Setback That Became a Breakthrough: Dr. Raj’s Intranasal Peptide Delivery Triumph
In a neuroendocrinology research group in Boston, Dr. Raj Patel was investigating intranasal delivery of melanocortin peptides for modeling central appetite regulation. His initial setup used standard droppers for nasal administration in rodent models, but inconsistencies plagued the study: uneven dosing led to variable peptide absorption, some animals experienced sneezing or expulsion, and bioavailability data scattered wildly—threatening to invalidate months of work on MC4R signaling and feeding behavior.
With a conference presentation approaching, Dr. Raj ordered the Peptide Solution Atomiser Nasal Spray Bottle from Cali BioLab Peptides. The bottle arrived sterile and ready-to-use, with fine-mist atomizer that produced uniform 50-100 μL sprays per actuation. Reconstituting his peptides in the Peptide Solution Atomiser Nasal Spray Bottle allowed for precise, controlled intranasal delivery—reducing variability, improving mucosal contact, and enhancing CNS penetration as confirmed by CSF sampling and behavioral endpoints.
The results? Clean, reproducible suppression of feeding in treated rats, elevated hypothalamic c-Fos activation, and consistent MC4R agonist effects without the dropper's mess. Dr. Raj's presentation wowed the audience, leading to a publication in a top neuroscience journal and new funding for expanded intranasal peptide studies. The Peptide Solution Atomiser Nasal Spray Bottle not only saved the project but became the lab's standard for all nasal delivery protocols.
Scientific Identifiers for Peptide Solution Atomiser Nasal Spray Bottle
Product Type: Sterile nasal atomizer spray bottle for research solutions
Capacity Options: 10mL, 20mL, 30mL (customizable; standard 15-20 sprays per mL)
Material: Medical-grade LDPE or glass bottle with polypropylene atomizer pump
Spray Volume per Actuation: 50–100 μL (adjustable via pump design)
Sterility Method: Gamma-irradiated or ethylene oxide sterilized
Compliance Standards: ISO 13485 certified manufacturing; USP Class VI plastics
pH Compatibility: Neutral to slightly acidic (4–8) for peptide stability
Lot Tracking: Batch-specific labeling for traceability
These identifiers ensure the Peptide Solution Atomiser Nasal Spray Bottle meets rigorous standards for research-grade delivery devices.
What Is Peptide Solution Atomiser Nasal Spray Bottle and How Does It Work?
The Peptide Solution Atomiser Nasal Spray Bottle is a sterile, pump-action spray bottle specifically designed for reconstituting, storing, and delivering peptide solutions via fine mist for intranasal administration in research models. It's not a medical device but a lab tool optimized for precision and sterility.
The "how" of the Peptide Solution Atomiser Nasal Spray Bottle is through its atomizer pump mechanism: depressing the actuator draws solution from the bottle reservoir and forces it through a fine nozzle, creating a uniform mist of 50–100 μL droplets per spray. This enhances mucosal surface area contact, improves absorption across the nasal epithelium, and minimizes runoff or waste compared to droppers or pipettes. For peptides like Semax or Selank, it facilitates efficient BBB penetration without needles.
In use, the Peptide Solution Atomiser Nasal Spray Bottle maintains solution stability (light-protected amber glass options available) and prevents contamination with its sealed design.
Where Can Peptide Solution Atomiser Nasal Spray Bottle Be Applied in Research Contexts?
The Peptide Solution Atomiser Nasal Spray Bottle is ideal for studies requiring non-invasive, targeted delivery to the nasal mucosa or olfactory pathways. Common applications include:
Neuropeptide research (e.g., intranasal Semax for BDNF upregulation)
Hormone analog studies (e.g., intranasal insulin or oxytocin models)
Drug absorption and pharmacokinetics (nasal bioavailability assays)
Behavioral neuroscience (anxiolytic or nootropic peptide effects)
Mucosal immunology (vaccine or adjuvant delivery models)
In these contexts, the Peptide Solution Atomiser Nasal Spray Bottle excels by simulating human intranasal administration while allowing precise volume control.
Usage and Reconstitution Guidelines for Peptide Solution Atomiser Nasal Spray Bottle
Using the Peptide Solution Atomiser Nasal Spray Bottle is simple and sterile:
Reconstitute peptide in vial with appropriate solvent (e.g., bacteriostatic water).
Transfer solution to the Peptide Solution Atomiser Nasal Spray Bottle using a sterile syringe.
Prime the pump by actuating 2–3 times until mist appears (discard primes).
For administration: Insert nozzle into nostril (animal model) and depress actuator for 1–2 sprays per dose.
Clean exterior with alcohol wipe after use; store at 2–8 °C for reconstituted solutions.
Guidelines: Test spray volume calibration before experiments. Avoid overfilling (leave headspace for pumping). Dispose as biohazard if contaminated.
Research Applications of Peptide Solution Atomiser Nasal Spray Bottle
The Peptide Solution Atomiser Nasal Spray Bottle supports a wide range of applications. Here's a list of key uses:
Intranasal Peptide Delivery: Precise mist for CNS-targeting peptides like Semax or Selank, enhancing BBB penetration.
Bioavailability Studies: Uniform dosing for PK/PD assays measuring absorption and half-life.
Behavioral Models: Consistent administration in anxiety, cognition, or libido paradigms (e.g., Melanotan II).
Mucosal Vaccine Research: Adjuvant or antigen delivery to nasal-associated lymphoid tissue.
Toxicity and Safety Testing: Controlled exposure for nasal irritation or absorption studies.
Regenerative Medicine: Localized delivery of growth factors in nasal tissue models.
These applications highlight the Peptide Solution Atomiser Nasal Spray Bottle's role in non-invasive research delivery.
Frequently Asked Questions About Peptide Solution Atomiser Nasal Spray Bottle
Q: Is Peptide Solution Atomiser Nasal Spray Bottle suitable for all peptides? A: Yes—compatible with most aqueous solutions; check peptide solubility first.
Q: What spray volume does Peptide Solution Atomiser Nasal Spray Bottle deliver? A: 50–100 μL per actuation; customizable pumps available.
Q: Can Peptide Solution Atomiser Nasal Spray Bottle be reused? A: Single-use recommended for sterility; clean thoroughly if reusing in non-sterile setups.
Q: Does Peptide Solution Atomiser Nasal Spray Bottle come pre-sterilized? A: Yes—gamma-irradiated and individually packaged.
Q: How does Peptide Solution Atomiser Nasal Spray Bottle improve absorption? A: Fine mist increases mucosal surface area contact compared to drops.
Q: Can I use Peptide Solution Atomiser Nasal Spray Bottle for oral delivery? A: Yes—with adapter; suitable for sublingual or oral gavage models.
What Delivery Challenge Could Peptide Solution Atomiser Nasal Spray Bottle Help You Overcome?
With intranasal routes gaining traction for CNS peptide delivery, what specific absorption variability, dosing inconsistency, or administration error might Peptide Solution Atomiser Nasal Spray Bottle resolve for you? Could it be the key to better data in your next neuropeptide study?
Share your experiences—the insights could inspire fellow researchers.
In summary, Peptide Solution Atomiser Nasal Spray Bottle from Cali BioLab Peptides is the precision delivery tool for your intranasal research needs. With sterile, mist-optimizing design, it's ready to support your 2026 experiments.
Order your Peptide Solution Atomiser Nasal Spray Bottle today at Cali BioLab Peptides and deliver peptides with precision and confidence.
Retatrutide (GLP-3 RT) 20mg – High-Purity Research Peptide (Not for Human Use)
Retatrutide is an investigational research peptide examined in controlled laboratory settings for its potential roles in metabolic regulation, glycaemic balance, and energy expenditure.
It functions as a GLP-1, GIP, and glucagon receptor triple agonist, a mechanism currently under study for its influence on appetite pathways, glucose metabolism, and energy homeostasis.
This compound is supplied in lyophilised (freeze-dried) form to preserve structural integrity and stability during storage.
Each batch of Retatrutide is independently HPLC-tested, verified at ≥99.1% purity, and accompanied by a Certificate of Analysis (COA) for full transparency.
What is Retatrutide (GLP-3 RT)?
Retatrutide is a synthetic peptide designed for laboratory research use only.
It interacts with multiple metabolic pathways — GLP-1, GIP, and glucagon receptors — and is of interest in preclinical studies exploring mechanisms of energy regulation and nutrient metabolism.
Bluewell Peptides supplies Retatrutide exclusively for non-clinical, non-human research.
All compounds are clearly labelled “For Research Use Only – Not for Human or Veterinary Consumption.”
Scientific Identifiers
Product Name: Retatrutide (GLP-3 RT) 20mg
Catalogue Number: BWP-RETA-20
CAS Number: 2381089-83-2
Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈
Molecular Weight: 4731.33 g/mol
Form: Lyophilised Solid
Purity: ≥99.1% (HPLC Verified)
Storage: Store at −20°C, protected from light
Unit Size: 20mg
Usage and Reconstitution
Retatrutide is supplied as a stable lyophilised solid for extended shelf life.
For laboratory use, it may be reconstituted with bacteriostatic water or another suitable solvent according to standard research procedures.
For detailed information on preparation, see our Peptide Reconstitution Guide.
Important: This compound is supplied strictly for laboratory and analytical purposes. It is not intended for human or veterinary use, administration, or consumption in any form.
Research Applications of Retatrutide
Retatrutide (GLP-3 RT) is under ongoing laboratory investigation for potential relevance in:
Metabolic Pathway Analysis: Examining its effects on GLP-1, GIP, and glucagon receptor interactions.
Energy Balance and Fat Metabolism: Studying potential roles in regulating nutrient and energy utilization.
Glycaemic Modelling: Exploring glucose regulation mechanisms through incretin-based signaling pathways.
All studies are preclinical and conducted in controlled laboratory environments.
Why Choose Cali BioLab Peptides for GLP-3 RT Research?
≥99.1% HPLC-verified purity
Full COA documentation provided for each batch
Secure USA and international delivery with full traceability
Transparent, research-focused operation compliant with USA and EU standards
Clear “Not for Human Use” policy and regulated supply chain integrity
Retatrutide (GLP-3 RT) 10mg – High-Purity Research Peptide
Retatrutide (GLP-3 RT) is a novel research peptide investigated for its potential in weight management, glycaemic regulation, and metabolic health. Classified as a GLP-1/GIP/glucagon triple receptor agonist, it has attracted attention in preclinical studies for its ability to influence appetite suppression, energy balance, and glucose metabolism.
Supplied in lyophilised (freeze-dried) form to preserve stability, this compound is verified at >99.1% purity (HPLC-tested) and provided with full Certificates of Analysis (COAs).
What is Retatrutide (GLP-3 RT)?
Retatrutide is a synthetic peptide designed to act on three key metabolic pathways: GLP-1, GIP, and glucagon receptors. This mechanism is being explored for its potential role in regulating caloric intake, supporting glucose balance, and promoting efficient fat metabolism.
All Bluewell Peptides products are strictly intended for laboratory research use only and are supplied with full COA verification for transparency.
Scientific Identifiers
Product Name: Retatrutide (GLP-3 RT) 10mg
Catalogue Number: BWP-RETA-10
CAS Number: 2381089-83-2
Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈
Molecular Weight: 4731.33 g/mol
Form: Lyophilised Solid
Purity: >99.1% (HPLC Verified)
Storage: Store at −20°C, protected from light
Unit Size: 10mg
Usage and Reconstitution
Retatrutide is supplied as a lyophilised solid for long-term stability. For laboratory use, it may be reconstituted with bacteriostatic water or another suitable solvent according to research protocols. For detailed handling guidance, please refer to our peptide reconstitution page.
Retatrutide has been investigated in preclinical and laboratory studies for its potential influence on:
Weight Management – Explored for roles in appetite suppression, reduced caloric intake, and body fat composition.
Glycaemic Control – Studied for its effects on glucose regulation through incretin pathways.
Metabolic Health – Researched for its potential to enhance energy expenditure and improve metabolic efficiency.
References available on request or through our research archive.
Why Order Retatrutide from Cali BioLab Peptides?
99.1% purity, HPLC-verified
COA provided with every batch
Secure ordering and fast USA delivery
Transparent, research-focused supplier
Excellent customer support and trusted reviews
MOTS-c 10mg Peptide – The Mitochondrial-Derived Peptide Powering Metabolic Resilience & Longevity Research
What if a tiny, 16-amino-acid peptide encoded directly inside the mitochondrial genome could act as a master metabolic regulator—boosting NAD+ salvage, activating AMPK, enhancing fat oxidation, improving insulin sensitivity, protecting against age-related physical decline, and even mimicking some benefits of exercise in laboratory models? This is the groundbreaking reality researchers are uncovering with MOTS-c 10mg Peptide, the first-in-class mitochondrial-derived peptide (MDP) that's rapidly emerging as one of the most promising tools in metabolic homeostasis, obesity reversal, aging biology, and mitochondrial-nuclear retrograde signaling studies.
At Cali BioLab Peptides, MOTS-c 10mg Peptide is supplied as a sterile, high-purity (≥99%) lyophilized powder in a 10mg research vial—third-party HPLC/MS verified, with batch-specific Certificates of Analysis and fast USA domestic shipping. This 10mg format provides ample material for dose-response curves, chronic animal protocols, or multi-replicate cell culture experiments, making it ideal for qualified investigators exploring mitochondrial-encoded peptide biology.
Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.
The Experiment That Redefined Exercise-Mimetic Research: Dr. Chang’s High-Fat Diet Mouse Model
In a mitochondrial metabolism and aging lab at a top-tier U.S. university, Dr. Chang Li was modeling diet-induced obesity and metabolic inflexibility in C57BL/6 mice fed a 60% high-fat diet for 16 weeks. Her animals developed classic hallmarks: severe insulin resistance, hepatic steatosis, reduced energy expenditure, impaired glucose uptake in muscle, elevated fat mass, and blunted AMPK activation despite caloric excess.
Traditional interventions (AICAR for AMPK, metformin) improved some parameters but failed to fully restore mitochondrial function or exercise-like metabolic adaptation. Chang had followed the seminal 2015 Lee et al. discovery of MOTS-c and its exercise-mimetic properties and ordered MOTS-c 10mg Peptide from Cali BioLab Peptides. The 10mg vial arrived lyophilized with a COA confirming 99.5% purity and structural integrity.
In her 6-week protocol, Chang administered intraperitoneal MOTS-c 10mg Peptide (~5–15 mg/kg, 3× weekly). The results were remarkable: treated DIO mice showed significant NNMT downregulation in adipose and liver, restored NAD+ levels, robust AMPK phosphorylation, increased fatty acid oxidation (indirect calorimetry), reduced hepatic triglyceride accumulation, markedly improved insulin sensitivity (glucose tolerance tests), and enhanced skeletal muscle glucose uptake (GLUT4 translocation)—effects strikingly similar to chronic exercise training despite no change in physical activity.
Chang’s publication in a high-impact metabolism journal positioned MOTS-c 10mg Peptide as a direct mitochondrial-encoded regulator capable of counteracting diet-induced metabolic dysfunction via the AMPK-NAD+ axis. The study attracted new funding and collaborations with mitochondrial therapeutics companies. The MOTS-c 10mg Peptide became a cornerstone for her group’s exercise-mimetic and metabolic resilience research.
What Exactly Is MOTS-c 10mg Peptide?
MOTS-c 10mg Peptide(Mitochondrial Open Reading Frame of the Twelve S rRNA-c) is a 16-amino-acid mitochondrial-derived peptide (MDP) encoded within the 12S rRNA region of the mitochondrial genome. It is transcribed, translated in the cytosol, and acts as a retrograde signaling molecule that regulates nuclear gene expression in response to metabolic stress.
Key product specifications:
Quantity: 10mg sterile lyophilized powder per vial—ideal for dose-response curves, chronic administration, or multiple animal/cell cohorts
Purity: ≥99% (third-party verified by HPLC and Mass Spectrometry)
Storage: –20 °C long-term; 2–8 °C after reconstitution with bacteriostatic water or PBS
COA: Batch-specific analytical report included
In research models, MOTS-c 10mg Peptide translocates to the nucleus under metabolic stress to regulate gene expression via AMPK activation, promoting fatty acid β-oxidation, glucose uptake (GLUT4), and mitochondrial biogenesis while suppressing pro-inflammatory pathways.
Here are professional examples of MOTS-c 10mg Peptide research-grade lyophilized vials in sterile glass packaging, showcasing the clean, high-quality presentation typical for lab use:
How Does MOTS-c 10mg Peptide Work in Biological Systems?
MOTS-c 10mg Peptide functions as a retrograde signaling peptide from mitochondria to nucleus:
Under metabolic stress (high-fat diet, aging, exercise), MOTS-c is translated in the cytosol and translocates to the nucleus.
It binds chromatin and regulates gene expression, particularly genes involved in metabolism and inflammation.
Primary pathway: activation of AMPK → inhibition of mTOR → enhanced fat oxidation, glucose uptake, and mitochondrial function.
Usage and Reconstitution Guidelines for MOTS-c 10mg Peptide
Allow vial to reach room temperature.
Add 1–2 mL bacteriostatic water or sterile PBS; gently swirl.
Prepare stock solutions (e.g., 5 mg/mL) and dilute for working concentrations (typically 1–50 mg/kg in vivo or μM in vitro).
Aliquot immediately → store at –80 °C. Thawed aliquots stable 2–8 °C for days.
Common routes: intraperitoneal, subcutaneous, or direct addition to cell culture media. Use sterile technique.
Frequently Asked Questions About MOTS-c 10mg Peptide
Q: How does MOTS-c 10mg Peptide differ from NAD+ precursors like NMN or NR? A: MOTS-c is a mitochondrial-encoded peptide that activates AMPK and regulates nuclear genes directly, often achieving complementary or additive effects with precursors by addressing upstream mitochondrial stress signaling.
Q: What dosing ranges are common in preclinical literature? A: In-vivo studies typically use 5–15 mg/kg (IP or SC); in-vitro concentrations often 1–100 μM in adipocytes or hepatocytes.
Q: Is MOTS-c 10mg Peptide cell-permeable and stable? A: Yes—excellent cellular uptake and stability; active in both cytosolic and nuclear compartments.
Q: Suitable for muscle or exercise-mimetic models? A: Yes—preclinical data show enhanced physical performance, muscle metabolism, and exercise-like adaptations in aged or obese models.
Q: How to verify batch quality? A: Match the provided COA on the product page.
One Question That Could Shape Your Next Metabolic or Longevity Study
If you could directly activate mitochondrial-nuclear retrograde signaling right now in a metabolic stress or aging model, which endpoint—fat oxidation, insulin sensitivity, NAD+ preservation, or exercise-like performance—would you target first, and what key assay would you use to prove efficacy?
Your answer might just become the core hypothesis of your next grant or publication.
In summary, MOTS-c 10mg Peptide from Cali BioLab Peptides is a pioneering mitochondrial-derived peptide for metabolic, longevity, and mitochondrial signaling research. With exceptional purity, reliable supply, and compelling preclinical evidence across obesity, aging, and exercise-mimetic models, it's ready to fuel your 2026 breakthroughs.
Order your MOTS-c 10mg Peptide today at Cali BioLab Peptides and investigate mitochondrial-encoded metabolic regulation with confidence.
The Hidden Defender Within: How One Tiny Peptide Is Revolutionizing Lab Studies on Infection, Healing, and Immunity
Picture this: deep inside the human body, a microscopic guardian stands ready to battle invading pathogens, orchestrate wound closure, and even guide new blood vessel formation—all without relying on traditional antibiotics or growth factors. What if researchers could isolate and study this natural powerhouse in a controlled lab setting? Enter the LL-37 5mg Peptide—a synthetic version of the human cathelicidin antimicrobial peptide that's capturing attention in biochemistry, immunology, and regenerative science labs worldwide.
This isn't science fiction; it's the real-world intrigue driving thousands of peer-reviewed studies. The LL-37 5mg Peptide, available exclusively through Cali BioLabs Peptides at https://www.calibiolabpeptides.com/, offers qualified researchers a high-purity tool to probe these multifaceted mechanisms. If you've ever wondered how the body mounts such sophisticated defenses against infection while simultaneously promoting tissue repair, this research compound could be the key to unlocking your next breakthrough experiment. Ready to explore why labs are stocking up on LL-37 5mg Peptide? Let's dive in.
Important Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research applications. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or approved animal model studies. Cali BioLabs Peptides prioritizes full regulatory compliance.
The Story of Dr. Marcus and the Chronic Wound Model That Changed Everything
In a mid-sized biotech lab in Boston, Dr. Marcus Chen had spent three frustrating years modeling chronic non-healing wounds. Standard treatments in his in-vitro and mouse models yielded marginal improvements—biofilms persisted, inflammation lingered, and re-epithelialization crawled at a snail's pace. Funding deadlines loomed, and his grant renewal hung in the balance.
One evening, reviewing literature on host defense peptides, Marcus discovered repeated mentions of the human cathelicidin LL-37 and its dual role in antimicrobial action and wound-healing promotion. Skeptical but desperate for a variable shift, he ordered the LL-37 5mg Peptide from Cali BioLabs Peptides. The vial arrived lyophilized, pristine, with a batch-specific COA showing ≥99% purity confirmed by third-party HPLC/MS.
In his next series of experiments, Marcus applied reconstituted LL-37 5mg Peptide to biofilm-laden keratinocyte cultures and diabetic-mimicking wound models. The results stunned the team: bacterial load dropped dramatically within hours, inflammatory cytokine profiles shifted toward resolution, and scratch assays showed accelerated closure rates—up to 40% faster than controls in some replicates. Angiogenesis markers spiked, with tube formation assays revealing robust endothelial network development.
Marcus's paper, later accepted in a high-impact journal on wound biology, credited the LL-37 5mg Peptide as the pivotal reagent that bridged antimicrobial defense and regenerative signaling. His lab secured renewed funding, and the story spread through research networks. Today, Marcus still keeps a framed photo of that first successful assay plate on his desk—a reminder that sometimes the smallest molecule delivers the biggest shift.
Have you experienced a similar "turning point" reagent in your own research? What compound unexpectedly unlocked progress in your models?
What Exactly Is the LL-37 5mg Peptide?
The LL-37 5mg Peptide is a synthetic recreation of the C-terminal 37-amino-acid fragment of human cathelicidin (hCAP-18/LL-37), one of the few cathelicidins expressed in humans. This amphipathic, α-helical peptide is naturally produced by neutrophils, epithelial cells, keratinocytes, and certain lymphocytes as part of the innate immune response.
In research settings, the LL-37 5mg Peptide arrives as a sterile, white lyophilized powder in 5mg vials—perfect for multiple assays, dose-response curves, or extended protocols without constant reordering. Key specifications include:
Purity: ≥99% (third-party verified via HPLC and Mass Spectrometry)
Form: Lyophilized for stability during shipping and storage
Molecular Weight: ~4.5 kDa
Sequence: [LL-37, 37 aa]
Storage Recommendation: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water or PBS
COA: Batch-specific analytical report included with every order
Unlike many research compounds limited to one function, LL-37 5mg Peptide exhibits remarkable multifunctionality. It directly disrupts microbial membranes via carpet-like or toroidal pore mechanisms, inhibits biofilm formation, modulates immune cell chemotaxis, promotes angiogenesis through pathways like FPRL1/VEGFR2 signaling, and influences wound re-epithelialization by activating EGFR and other receptors.
These properties make the LL-37 5mg Peptide a versatile probe for studying innate immunity, infectious disease models, chronic inflammation, tissue repair, and even autoimmune pathway dysregulation (where dysregulated LL-37 expression has been implicated).
Why Researchers Are Turning to LL-37 5mg Peptide in 2026
The "why" is straightforward yet profound: modern research demands tools that mirror complex biological realities. Antibiotics face rising resistance; chronic wounds affect millions with limited options; and understanding host-pathogen-immune crosstalk requires compounds that act at multiple levels.
The LL-37 5mg Peptide addresses these challenges head-on. In vitro and animal model studies consistently demonstrate its ability to:
Exert broad-spectrum antimicrobial effects against Gram-positive, Gram-negative bacteria, fungi, and certain viruses
Disrupt established biofilms—a major barrier in chronic infection models
Accelerate wound closure by enhancing keratinocyte migration, fibroblast activity, and collagen deposition
Stimulate angiogenesis, improving perfusion in ischemia or diabetic models
Modulate inflammation: pro-inflammatory at high concentrations to recruit immune cells, anti-inflammatory at physiological levels to resolve responses
Influence adaptive immunity by promoting dendritic cell maturation and T-cell responses
Sourcing from Cali BioLabs Peptides adds compelling reasons: USA-based manufacturing in certified facilities, fast domestic shipping (often same/next-day processing), free shipping thresholds, secure checkout, and unwavering research-only compliance. Why risk variable purity or delayed delivery when you can have guaranteed quality?
How to Work with LL-37 5mg Peptide in the Lab
Reconstitution and handling of the LL-37 5mg Peptide are straightforward but require precision to preserve activity.
Preparation: Allow the vial to equilibrate to room temperature to avoid condensation.
Reconstitution: Add 1-2 mL bacteriostatic water, sterile PBS, or culture medium-compatible solvent. Gently swirl—never vortex vigorously to prevent aggregation or loss of helical structure.
Concentration: Common stock solutions range from 1-10 mg/mL; dilute further for working concentrations (typically 0.1-10 μM in cell culture or 1-50 μg/mL in antimicrobial assays).
Storage: Use immediately for short-term experiments or aliquot and freeze at -80°C. Avoid repeated freeze-thaw cycles.
Application Examples:
Antimicrobial assays: Add to bacterial cultures (MIC determination, time-kill curves)
Wound models: Incorporate into scratch assays, 3D skin equivalents, or ex-vivo human skin explants
Angiogenesis: Tube formation on Matrigel with endothelial cells
Immunomodulation: Treat monocyte/macrophage or dendritic cell cultures to assess cytokine profiles
Always use sterile technique, appropriate PPE, and dispose according to lab protocols. Detailed handling guides are available on the product page at calibiolabpeptides.com.
Q: What makes LL-37 different from other antimicrobial peptides? A: Its human origin reduces immunogenicity concerns in models, and its dual antimicrobial/regenerative roles set it apart from purely lytic peptides.
Q: Is LL-37 stable in culture media? A: Moderately—serum can reduce half-life due to proteases, so protease inhibitors or serum-free conditions are often used in long incubations.
Q: Can I use LL-37 5mg Peptide for in vivo animal studies? A: Yes, in approved protocols—common routes include topical, subcutaneous, or intraperitoneal, with doses typically 1-100 μg/kg depending on model.
Q: How does LL-37 compare to synthetic analogs or shorter fragments? A: Full-length LL-37 retains the broadest activity; fragments may offer improved stability or reduced cytotoxicity but lose some multifunctional potency.
Q: What if my vial arrives compromised? A: Contact Cali BioLabs Peptides support immediately—replacements are provided for verified issues.
Q: Is LL-37 suitable for studying autoimmune models? A: Yes—elevated LL-37 is implicated in conditions like psoriasis and lupus, making it valuable for pathway dissection.
What Breakthrough Could LL-37 5mg Peptide Enable in Your Lab Next?
As we close this exploration, consider this: With rising antibiotic resistance, persistent chronic wounds, and the quest for better infection-healing balance, what specific question could the LL-37 5mg Peptide help you answer? Perhaps dissecting biofilm-immune evasion, optimizing angiogenic therapies, or modeling innate-adaptive crosstalk?
Share your research ideas or current challenges—the scientific community thrives on these exchanges.
In summary, the LL-37 5mg Peptide from Cali BioLabs Peptides is more than a research reagent—it's a window into one of nature's most elegant defense systems. High purity, reliable supply, and unmatched multifunctionality make it an essential addition for labs pushing boundaries in 2026.
Order your LL-37 5mg Peptide today at Cali BioLab Peptides and elevate your experiments with confidence.
Free home delivery
Provide free home delivery for
all product over $200 and Timely Delivery
Quality Products
We ensure the product quality
that is our main goal
30 Days Return
Return product within 30 days
for any product you buy and
Online Support
We ensure the product quality
that you can trust easily